StemCell Therapy

BTEC110: Basic Techniques in Biotechnology

Units: 4Prerequisites: BIO105 and CHEM140 or one year of high school chemistry (within 4 years), or qualification through a chemistry placement exam.Advisory: ACE150, ENGL50, ESL150, or eligibility determined by the English placement process.Acceptable for Credit: CSULecture 2 hours, laboratory 6 hours. Course Typically Offered: Fall, Spring

This course focuses on the basic laboratory skills needed for employment in the bioscience/biotechnology industry. Students learn laboratory safety and documentation while acquiring skills in the maintenance and calibration of basic lab equipment, calculation and preparation of lab solutions and media, and routine handling of both bacterial and mammalian cell cultures (tissue culture). Students also develop fundamental skills in spectroscopy, centrifugation, performance of assays, gel electrophoresis, and the purification and handling of biological molecules, such as proteins and DNA. (Materials Fee: $30.00)

BTEC120: Business and Regulatory Practices in Biotechnology

Units: 3Prerequisites: NoneAcceptable for Credit: CSULecture 3 hours. Course Typically Offered: Fall, Spring

This course examines basic business principles and practices utilized in the discovery, development, and production phases of new product development. It explores the role of governmental oversight and regulation in assuring the safety, efficacy, and quality of a biotechnology product.

BTEC180: Biostatistics

Units: 4Prerequisites: MATH64, MATH102, or eligibility determined by the math placement process.Advisory: BIO105, BIO110, BIO111, BIO202, or BIO204.Enrollment Limitation: Not open to students with prior credit in BIO 180, BUS204, PSYC104, PSYC104H, SOC104, or SOC104H.Acceptable for Credit: CSU, UCLecture 3 hours, laboratory 3 hours. Course Typically Offered: Fall, Spring

This introductory statistics course covers the principles and practice of statistical design and analysis for scientific experimentation. Topics include hypothesis formation, experimental design and execution, data analysis, and communication with application to scientific fields, such as the biological and health sciences. The course includes laboratory application with extensive use of computer software for statistical analysis and simulation. UC CREDIT LIMITATION: Credit for BIO 180/BTEC180, BUS204, MATH103, PSYC104/SOC104, or PSYC104H/SOC104H.

BTEC201: Advanced Cell Culture

Units: 1Prerequisites: BTEC110.Acceptable for Credit: CSULecture 0.50 hour, laboratory 1.50 hours. Course Typically Offered: Spring

This advanced course teaches skills in the proper handling of cells from higher organisms, such as plants, mammals, and insects, that are routinely maintained in culture in the biotechnology laboratory. Instruction focuses on growth and manipulation techniques and long-term maintenance of various laboratory cell cultures that may include anchorage-dependent and suspension cell lines as well as stem cell cultures.

BTEC203: Techniques in DNA Amplification

Units: 1Prerequisites: BTEC110.Acceptable for Credit: CSULecture 0.75 hour, laboratory 0.75 hour. Course Typically Offered: Fall or Spring every 3rd sem

This advanced course provides skills in the performance of the polymerase chain reaction (PCR), a technique commonly used to amplify DNA in forensics and the biotechnology laboratory. Instruction focuses on understanding the process; potential applications of DNA amplification; and the skills related to the setup, performance, and evaluation of the technique's outcome. The course assumes some prior knowledge of solution preparation and gel electrophoresis.

BTEC204: Recombinant DNA

Units: 1Prerequisites: BTEC110.Acceptable for Credit: CSULecture 0.75 hour, laboratory 0.75 hour. Course Typically Offered: Fall or Spring every 3rd sem

This advanced course provides skills in recombinant DNA technology used to analyze and manipulate DNA in the biotechnology laboratory. Students learn about the process of cloning and analyzing DNA and acquire the skills necessary to cut, piece together, and introduce new DNA molecules into prepared host bacterial cells.

BTEC206: Principles of Separation and HPLC

Units: 1Prerequisites: BTEC110.Acceptable for Credit: CSULecture 0.75 hour, laboratory 0.75 hour. Course Typically Offered: Fall or Spring every 3rd sem

This advanced course provides skills in the separation of biomolecules from complex mixtures using high performance liquid chromatography (HPLC). Instruction focuses on understanding the principles of separation, acquiring skills in the separation of various biomolecules, and analyzing the outcome for the purpose of determining system performance and biomolecular purification. The course assumes some prior knowledge of solution preparation, assays, and spectroscopy.

BTEC207: Techniques in Immunochemistry and ELISA

Units: 1Prerequisites: BTEC110.Acceptable for Credit: CSULecture 0.75 hour, laboratory 0.75 hour. Course Typically Offered: Fall or Spring every 3rd sem

This advanced course provides skills in the use of antibody reagents as a tool in the biotechnology laboratory. It focuses on the nature and specificity of antibody reagents for the identification and quantification of biological molecules. Students learn how to set up, perform, and analyze techniques utilizing antibodies, such as Westerns and ELISAs.

BTEC210: Data Analysis with Excel

Units: 1Prerequisites: NoneAdvisory: CSIT101.Acceptable for Credit: CSULecture 0.75 hour, laboratory 0.75 hour. Course Typically Offered: Fall, Spring

This course teaches students how modern spreadsheet programs can be used to collect and organize data for subsequent tabulation, summarization, and graphical display. It utilizes various forms of scientific data to teach the techniques and skill that facilitate the capture, analysis, and management of data. Topics include importing and organizing data, filtering and sorting, graphing, and statistical analysis functions.

BTEC211: Technical Writing for Regulated Environments

Units: 1Prerequisites: NoneAdvisory: BTEC110 and ACE150, ENGL50, ESL150, or eligibility determined by the English placement process.Acceptable for Credit: CSULecture 1 hour. Course Typically Offered: Fall, Spring

This course provides the requisite tools to understand why technical writing exists and how that writing works in conjunction with the many types of documents found in regulated environments. It also develops the techniques needed to deliver clear and complete passages with precise language. Students apply best practices for technical writing to a variety of documents, including reports, standard operating procedures (SOP), and investigations.

BTEC221: Bioprocessing: Cell Culture and Scale-up

Units: 1.5Prerequisites: BTEC110.Advisory: BTEC120.Acceptable for Credit: CSULecture 0.75 hour, laboratory 2.25 hours. Course Typically Offered: Fall, Spring

This laboratory course develops the skills and knowledge related to the culture of cells in increasingly larger scales for the production of biological molecules. Students grow and monitor a variety of cells (bacterial, yeast, and/or mammalian) on a laboratory scale that emulates the large-scale production used in industry. They become familiar with the cleaning, sterilization, aseptic inoculation, operation, and monitoring of fermenters and bioreactors. The course emphasizes the use of current Good Manufacturing Practices (cGMPs) and process control strategies, and students gain experience following Standard Operating Procedures (SOPs).

BTEC222: Bioprocessing: Large Scale Purification

Units: 1.5Prerequisites: BTEC110.Advisory: BTEC120.Acceptable for Credit: CSULecture 0.75 hour, laboratory 2.25 hours. Course Typically Offered: Fall, Spring

This laboratory course develops the skills and knowledge related to purification of biological molecules produced on a large scale. Students utilize the most common types of separation equipment, including tangential flow filtration, centrifugation, and column chromatography. They become familiar with the cleaning, sanitization, calibration, operation, and monitoring of large-scale purification equipment. The course emphasizes the use of current Good Manufacturing Practices (cGMPs) and process control strategies, and students gain experience following Standard Operating Procedures (SOPs).

BTEC292: Internship Studies

Units: 0.5-3Prerequisites: NoneCorequisite: Complete 75 hrs paid or 60 hrs non-paid work per unit.Enrollment Limitation: Instructor, dept chair, and Career Center approval. May not enroll in any combination of cooperative work experience and/or internship studies concurrently.Acceptable for Credit: CSUCourse Typically Offered: To be arranged

This course provides students the opportunity to apply the theories and techniques of their discipline in an internship position in a professional setting under the instruction of a faculty-mentor and site supervisor. It introduces students to aspects of the roles and responsibilities of professionals employed in the field of study. Topics include goal-setting, employability skills development, and examination of the world of work as it relates to the student's career plans. Students must develop new learning objectives and/or intern at a new site upon each repetition. Students may not earn more than 16 units in any combination of cooperative work experience (general or occupational) and/or internship studies during community college attendance.

BTEC296: Topics in Biotechnology

Units: 1-4Prerequisites: NoneAcceptable for Credit: CSULecture 1 hour.Lecture 2 hours.Lecture 3 hours.Lecture 4 hours. Course Typically Offered: To be arranged

This course gives students an opportunity to study topics in Biotechnology that are not included in regular course offerings. Each Topics course is announced, described, and given its own title and 296 number designation in the class schedule.

BTEC299: Occupational Cooperative Work Experience

Units: 1-6Prerequisites: NoneCorequisite: Complete 75 hrs paid or 60 hrs non-paid work per unit.Enrollment Limitation: Career Center approval. May not enroll in any combination of cooperative work experience and/or internship studies concurrently.Acceptable for Credit: CSUCourse Typically Offered: To be arranged

Cooperative Work Experience is intended for students who are employed in a job directly related to their major. It allows such students the opportunity to apply the theories and skills of their discipline to their position and to undertake new responsibilities and learn new skills at work. Topics include goal-setting, employability skills development, and examination of the world of work as it relates to the student's career plans. Students may not earn more than 16 units in any combination of cooperative work experience (general or occupational) and/or internship studies during community college attendance.

BTEC300: Supply Chain and Enterprise Resource Planning in Biomanufacturing

Units: 3Prerequisites: BTEC120.Enrollment Limitation: Only open to students enrolled in the bachelor's degree program in biomanufacturing at MiraCosta College.Lecture 3 hours. Course Typically Offered: Spring

Students gain knowledge of how companies manage the complete flow of materials in a supply chain from suppliers to customers. This course covers the design, planning, execution, monitoring, and control of raw materials, personnel resources, inventory management, and distribution. At the end students will have the knowledge required to take the CPIM (Certified in Production and Inventory Management) certification test administered by APICS (the American Production and Inventory Control Society). This course is open only to students enrolled in the biomanufacturing bachelor's degree program.

BTEC310: Biomanufacturing Process Sciences

Units: 5Prerequisites: BTEC221 and BTEC222.Enrollment Limitation: Only open to students enrolled in the bachelor's degree program in biomanufacturing at MiraCosta College.Lecture 3 hours, laboratory 6 hours. Course Typically Offered: Fall

This lecture/laboratory course examines the biological, physical, and chemical scientific principles that support the design, development, and optimization of key parameters in a biomanufacturing process. Process sciences covers the essential theories that underpin the biomanufacturing operations from product formation through product purification and how those operations scale up and scale down. The topics include fermenter and bioreactor design and the design of downstream processes that maximize the yield, safety, and efficacy of a protein pharmaceutical. This course is open only to students enrolled in the biomanufacturing bachelor's degree program.

BTEC320: Design of Experiments for Biomanufacturing

Units: 4Prerequisites: BTEC110, and BTEC180 or BIO 180.Enrollment Limitation: Only open to students enrolled in the bachelor's degree program in biomanufacturing at MiraCosta College.Lecture 3 hours, laboratory 3 hours. Course Typically Offered: Spring

This course teaches formalized design of experiments (DOE), a system that optimizes a process through the methodical varying of key parameters and a formalized approach to analyzing, interpreting, and applying the results. DOE is designed to make any process more robust and minimize variability from external sources. The course builds upon the statistical concepts required for DOE, including hypothesis testing, confidence intervals, statistical models, and analysis of variance (ANOVA). The DOE approach systematically varies the parameters of a biomanufacturing process to improve its operation. This course is open only to students enrolled in the biomanufacturing bachelor's degree program.

BTEC330: Advanced Topics in Quality Assurance and Regulatory Affairs

Units: 4Prerequisites: BTEC120.Enrollment Limitation: Only open to students enrolled in the bachelor's degree program in biomanufacturing at MiraCosta College.Lecture 4 hours. Course Typically Offered: Fall

This course builds upon previous knowledge of quality assurance and regulatory affairs to study the harmonized quality system approaches of the International Council for Harmonisation Q8 through Q11. The course pays special attention to the topics of quality risk management, qualification, and validation. This course is open only to students enrolled in the biomanufacturing bachelor's degree program.

BTEC340: Six Sigma and Lean Manufacturing

Units: 3Prerequisites: BTEC120 and BTEC180.Enrollment Limitation: Only open to students enrolled in the bachelor's degree program in biomanufacturing at MiraCosta College.Lecture 3 hours. Course Typically Offered: Spring

This course covers the Six Sigma approach to the maintenance and improvement of biomanufacturing processes. It incorporates the DMAIC phases: define, measure, analyze, improve, and control. The course covers the use and implementation of lean manufacturing tools that biomanufacturing companies use to reduce waste. This course is open only to students enrolled in the biomanufacturing bachelor's degree program.

BTEC360: Design of Biomanufacturing Facilities, Critical Utilities, Processes, and Equipment

Units: 3Prerequisites: BTEC120, BTEC221, and BTEC222.Enrollment Limitation: Concurrent Enrollment in BTEC221 and BTEC222 if prerequisites not met.Lecture 3 hours. Course Typically Offered: Fall

Students evaluate how the design of a biomanufacturing facility maintains appropriate levels of cleanliness and sterility and promotes the production of safe and effective products. Students analyze the design of the processes, equipment, and instrumentation used in biological production to generate critical utilities, aseptic systems, environmental control and monitoring, upstream production, and downstream (recovery and purification) production within a regulated environment. This course is open only to students enrolled in the biomanufacturing bachelor's degree program.

BTEC400: Bioprocess Monitoring and Control

Units: 4Prerequisites: BTEC310.Enrollment Limitation: Open only to students enrolled in the bachelor's degree program in biomanufacturing at MiraCosta College.Lecture 3 hours, laboratory 3 hours. Course Typically Offered: Fall

This course covers the measurement, monitoring, modeling, and control of biomanufacturing processes and the statistical methodology used for measuring, analyzing, and controlling quality during the manufacturing process, including control charts and the analysis of process capabilities. This course is open only to students enrolled in the biomanufacturing bachelor's degree program.

BTEC410: Methods in Quality, Improvements, Investigations, and Audits

Units: 4Prerequisites: BTEC330 and BTEC340.Enrollment Limitation: Only open to students enrolled in the bachelor's degree program in biomanufacturing at MiraCosta College.Lecture 4 hours. Course Typically Offered: Spring

This course examines investigational methods used by quality assurance departments to analyze process deviations and make decisions about severity of deviation. Students learn to write industry-standard corrective and preventive action (CAPA) reports to conclude what corrective and preventive actions result from the investigation. The course also covers how a company would perform an audit in anticipation of an inspection by the Food and Drug Administration or for the supplier of a key raw material. Course content is aligned with the American Society for Quality's Body of Knowledge for a Certified Quality Technician examination. This course is open only to students enrolled in the biomanufacturing bachelor's degree program.

BTEC460: Capstone Seminar in Biomanufacturing Technologies

Units: 3Prerequisites: BTEC310.Enrollment Limitation: Only open to students enrolled in the bachelor's degree program in biomanufacturing at MiraCosta College.Lecture 3 hours. Course Typically Offered: Fall

This course examines the breadth of products that are produced through biological processes. The course will focus on the advances and emerging technologies in biological production and purification operations. This course is open only to students enrolled in the biomanufacturing bachelor's degree program.

BTEC470: Capstone Seminar in Biomanufacturing Quality

Units: 3Prerequisites: BTEC330.Enrollment Limitation: Only open to students enrolled in the bachelor's degree program in biomanufacturing at MiraCosta College.Lecture 3 hours. Course Typically Offered: Spring

This course examines the process by which the quality systems of biomanufacturing evolve by examining a selected current trend in the laws and regulations governing biopharmaceutical manufacturing. Students evaluate the effectiveness of the laws and regulations governing biopharmaceutical manufacturing. This course serves as a capstone experience for students in biomanufacturing quality. This course is open only to students enrolled in the biomanufacturing bachelor's degree program.

Read the original post:
Biotechnology < MiraCosta College

Academics

On this page:

Biotechnology is the use of technology and applied biology to find solutions to problems. Career and research opportunities include animal sciences, biomedical technologies, immunology, pharmaceutics and forensics, plus marine and environmental science. Students learn the fundamentals of biology and chemistry and gain an advanced understanding of related subfields such as cellular biology, genetics and microbiology. Students work with DNA, cells, enzymes and other biological agents in hands-on laboratory settings and have the opportunity to work in outside laboratories as part of a summer internship program. Graduates find employment in entry-level biotechnology positions, including jobs as manufacturing, research and lab technicians, or transfer to a baccalaureate degree program.

The Biotechnology department offers an Associate in Science degree requiring a mix of general education and hands-on courses. The following courses are a sampling of what you might take as a student in this program and are subject to change.

Interested in seeing some of the current major-specific courses being offered as a part of this degree program?

If you are thinking about attending SMCC and are curious what the current program course requirements are to earn your degree, download the current SMCC Course Catalog.

If you are a current student, your program requirements may be different than those listed for the current catalog year. To view your specific program requirements or to search and register for courses, log in to MySMCC and visit the MyDegree webpage.

Please note, these estimates are based on a student taking an average of 15 credits per semester and do not include college preparatory or developmental courses.

For information about enrolling in the program contact:Admissions207-741-5800admissions@smccME.edu

For questions about this career path contact:Department ChairDaniel Moore207-741-5966dmoore@smccME.edu

" + this.title + "

" + (this.index + 1) + " of " + this.group.length + "

" + this.title + "

" + (this.index + 1) + " of " + this.group.length + "

" + this.title + "

" + (this.index + 1) + " of " + this.group.length + "

" + this.title + "

" + (this.index + 1) + " of " + this.group.length + "

" + this.title + "

" + (this.index + 1) + " of " + this.group.length + "

" + this.title + "

" + (this.index + 1) + " of " + this.group.length + "

" + this.title + "

" + (this.index + 1) + " of " + this.group.length + "

" + this.title + "

" + (this.index + 1) + " of " + this.group.length + "

" + this.title + "

" + (this.index + 1) + " of " + this.group.length + "

" + this.title + "

" + (this.index + 1) + " of " + this.group.length + "

" + this.title + "

" + (this.index + 1) + " of " + this.group.length + "

" + this.title + "

" + (this.index + 1) + " of " + this.group.length + "

" + this.title + "

Read this article:
Biotechnology - Southern Maine Community College

Lowest tuition & fees in Iowa

Page Content

An Liberal Arts Associate in Science Degree and theBiotechnology Laboratory Methods Certificate will prepare you for work in a laboratory position in a variety of companies and research institutions in Iowa and throughout the United States.

Withyour DMACC Biotechnology Certificate you can assist in cutting edge research in this fast growing and exciting scientific frontier or be an important link in the production of extremely important medical and industrial products!

The DMACC Liberal Arts Associate in Science Degree and the Biotechnology Certificate is also transferable to a four-year college or university so you can continue your science education in the field of your choice.

If you want to work in a professional environment in a very exciting field of science then you should seriously consider a degree in Biotechnology.

Program Chair/Biology Instructor

Ankeny Campus

Building 05, Room 1234

(515) 964-6379

Julie Gonzlez says one of the best things about teaching in the Biotechnology field is the ability to take students to local companies and show them the real world application of what they are learning at DMACC.

Students enjoy getting to meet DMACC Biotechnology alumni who are working in the field, said Gonzlez. The alumni always stop to talk to students about their own experiences.

DMACC Biotechnology graduates can work in several fields from agricultural to forensics. DMACC Biotechnology students learn how to analyze DNA for crime scene forensics and how to clone and sequence genes. Students also work with proteins to learn how diseases can be detected and monitored. They also examine enzymes that are used in the biofuels industry.

There is a demand for students who can use critical thinking skills and laboratory training to run experiments and analyze the results. There are many companies with a diverse range of opportunities available. If you are interested in biology and/or chemistry, there is a biotech job somewhere that would be perfect for you, said Gonzlez. Biotechnology is a growing field in central Iowa. The industry professionals I work with on DMACC's Biotechnology Advisory Committee often emphasize the need for educated biotechnology workers.

DMACC graduates can work for companies like Pioneer, Monsanto, Kemin, Proliant, Heska, NASA and the United States Department of Agriculture (USDA).

Gonzlez says lab exercises are a valuable part of the DMACC Biotechnology program.

From analyzing their favorite foods for genetically modified content to purifying proteins used to produce medications, the emphasis is on real-world techniques and applications, said Gonzlez.

Gonzlez earned a B.S. in Biology and Chemistry from Upper Iowa University and an M.S. and Graduate Certificate in Forensics from Iowa State University.

Gonzlez and her husband and two children enjoy many outdoor activities including biking, kayaking and stand-up paddling.

Read more:
DMACC Biotechnology Degree

Orthopaedic surgeon Dr. Stacie Grossfeld discussing Stem Cell Therapy.

Stem Cell Recruitment Therapy is a safe and effective treatment to helpyour body heal itself. It is typically administered during a normal office visit, through asingle injection. Patients have reported improved pain relief and repair for the following conditions:

Stem Cell injections are conveniently administered through a single injection during a normal office visit. Following the injection, patients are typically able to return to everyday, non-high impact activities within 24 to 48 hours.

What benefits does Stem Cell Recruitment Therapy offer?

For more information about stem cell recruitment therapy, or to make an appointment, callOrthopaedic Specialists at a (502)212-2663. Follow along for more information about stem cell recruitment therapy.

Stem cells for stem cell recruitment therapy are obtained through amniotic fluid. Amniotic fluid contains a multitude of proteins and growth factors. Together they create an extra-cellular matrix to recruit the bodys stem cells to reconstruct and regenerate the injured tissue that is causing pain. Amniotic fluid can repair tissue damage, giving patients with arthritis, joint injuries and soft tissue injuries a treatment option that does not involve pain masking medications or surgery.

The amniotic fluid is obtained during full-term cesarean births from healthy donors who have volunteered their placenta and amniotic fluid. All amniotic fluid is collected aseptically and tested prior to processing and determined to be eligible for transplantation by Donors Suitability Standards established by the AATB and the FDA. The products we use are FDA regulated under the 21 CFR Part 1271 and Section 361 of the Public Health and Service Act.

Stem cells take advantage of the bodys ability to repair itself. With a stem cell injection, your physician injects the amniotic fluid containing stem cells into your body. The amniotic fluid has anti-inflammatory properties, similar to cortisone and steroid shots. However, amniotic fluid goes far beyond the benefits of standard injection therapy.

While cortisone and other drugs only provide temporary pain relief, amniotic fluid actually restores degenerated tissue while providing pain relief. The growth factors in the amniotic fluid may recruit your bodys own stem cells, directly mitigating the repair and the regeneration of healthy tissue. Additionally, amniotic fluid injections contain hyaluronic acid, which lubricates joints and tendons, easing the pain and helping restore mobility.

Stem cells have over 200 growth factors. A growth factor is a proteins or enzyme that can grow cartilage, repair scars, reduce inflammation, take away pain, and grow bone. Astem cell can turn into any type of cell. Basically, it doesnt know what it wants to be when it grows up If you put it into the knee, it turns into the cells in the knee joint, it is an imitator so to speak, adapting to the environment where it is placed.

As we get older our stem cells get older. The amniotic stem cells are much more potent. The other advantage of the amniotic stem cells is that you do not have to have the painful procedure where stem cells are harvested out of your pelvis bone.

Typically it can take three to six weeks for a patient to feel the full effect of stem cell recruitment therapy. This is because the treatment utilizes the bodys own healing process.

Read the original here:
Stem Cell Therapy, Amniotic Fluid Injections, Pain Relief

An ideal injectable therapy would combine safe long term anti-inflammatory pain management and long term regenerative healing. The Center for Nonsurgical & Regenerative Orthopedics now offers the most sophisticated and powerful Stem Cell product on the market. ReNu is the only stem cell injection that combines the anti-inflammatory capacity of amniotic tissue with the regenerative power of fetal stem cells.

ReNu is a revolutionary noninvasive treatment in which human amniotic tissue and stem cells are injected into injured tissue to provide relief from pain and stimulate the body's natural healing process. This amniotic tissue contains fetal mesenchymal stem cells that help to regenerate damaged tissue such as cartilage, tendons, and ligaments. The growth factors in the amniotic tissue provide anti-inflammatory, anti-adhesive, and anti-microbial properties to the injured area and can significantly help reduce scarring for quicker healing. Amniotic tissue is also immune privileged, which means there is virtually no chance that your body will reject the treatment.

ReNu stem cells come from the amniotic membrane and fluid of donated placentas following normal childbirth. With the mother's consent, the amnion is removed and harvested from the placenta of pre-screened and tested donors. It is then sterilely processed and undergoes further rigorous testing to assure safety and efficacy. To be clear, while some people may have ethical issues with embryonic stem cell therapy, almost everyone agrees that the use of amniotic stem cell therapy raises no ethical or moral questions.

Continued here:
ReNu Stem Cell Therapy - Advanced Orthopedics - Nonsurgical ...

Stem cell therapy is a targeted treatment that activates your bodys own natural ability to heal and regenerate. With a simple in-office procedure you will improve your quality of life and potentially avoid surgery.

Research continues to show an increasing number of potential benefits from the anti inflammatory, immunomodulatory, and regenerative actions of stem cells. Stem cell therapy treats pain and chronic conditions at their source, returning you to the things you enjoy.

Our stem cell therapy treatment utilizes umbilical cord derived Mesenchymal Stem Cells from FDA regulated cord banks. Mesenchymal Stem Cells are specialized cells that are able to receive signals from the other cells in your body. Stem cells then seek out inflammation and degeneration and go to that location to begin repairing tissue.

Stem cells have been shown to help repair muscle, bone, cartilage and tendons. Research has indicated that stem cells can benefit a wide variety of health complications and may assist in individuals living stronger, healthier lives.

Our mission is simple: Change the lives of our patients by providing an integrative, holistic approach to healing.

We help people suffering from chronic health conditions, chronic pain, autoimmune issues, and many other undiagnosed syndromes and health problems.

We are passionate about caring for our patients who, until now, were not able to find answers and treatments for their underlying health issues.

Regenerative medicine through stem cell therapy is the future of health care and, for our patients, THE FUTURE IS NOW!

Are you a candidate for regenerative stem cell therapy? The answer is YES if you suffer from any of the following:

Were here to help you heal and restore your health today! Please contact us now using the form below to explore how stem cell therapy can help you find relief and embrace your life again!

More here:
Stem Cell Therapy in Richmond Start Healing Chronic Pain ...

Diabetic neuropathy is nerve damage that is caused by diabetes.

Nerves are bundles of special tissues that carry signals between your brain and other parts of your body. The signals

Types of diabetic neuropathy include the following:

Peripheral neuropathy is nerve damage that typically affects the feet and legs and sometimes affects the hands and arms.

Autonomic neuropathy is damage to nerves that control your internal organs. Autonomic neuropathy can lead to problems with your heart rate and blood pressure, digestive system, bladder, sex organs, sweat glands, eyes, and ability to sense hypoglycemia.

Focal neuropathies are conditions in which you typically have damage to single nerves, most often in your hand, head, torso, and leg.

Proximal neuropathy is a rare and disabling type of nerve damage in your hip, buttock, or thigh. This type of nerve damage typically affects one side of your body and may rarely spread to the other side. Proximal neuropathy often causes severe pain and may lead to significant weight loss.

If you have diabetes, your chance of developing nerve damage caused by diabetes increases the older you get and the longer you have diabetes. Managing your diabetes is an important part of preventing health problems such as diabetic neuropathy.

You are also more likely to develop nerve damage if you have diabetes and

Research also suggests that certain genes may make people more likely to develop diabetic neuropathy.

Over time, high blood glucose levels, also called blood sugar, and high levels of fats, such as triglycerides, in the blood from diabetes can damage your nerves. High blood glucose levels can also damage the small blood vessels that nourish your nerves with oxygen and nutrients. Without enough oxygen and nutrients, your nerves cannot function well.

Although different types of diabetic neuropathy can affect people who have diabetes, research suggests that up to one-half of people with diabetes have peripheral neuropathy.1,2 More than 30 percent of people with diabetes have autonomic neuropathy.2

The most common type of focal neuropathy is carpal tunnel syndrome, in which a nerve in your wrist is compressed. Although less than 10 percent of people with diabetes feel symptoms of carpal tunnel syndrome, about 25 percent of people with diabetes have some nerve compression at the wrist.2

Other focal neuropathies and proximal neuropathy are less common.

Your symptoms depend on which type of diabetic neuropathy you have. In peripheral neuropathy, some people may have a loss of sensation in their feet, while others may have burning or shooting pain in their lower legs. Most nerve damage develops over many years, and some people may not notice symptoms of mild nerve damage for a long time. In some people, severe pain begins suddenly.

Peripheral neuropathy can lead to foot complications, such as sores, ulcers, and infections, because nerve damage can make you lose feeling in your feet. As a result, you may not notice that your shoes are causing a sore or that you have injured your feet. Nerve damage can also cause problems with balance and coordination, leading to falls and fractures.

These problems may make it difficult for you to get around easily, causing you to lose some of your independence. In some people with diabetes, nerve damage causes chronic pain, which can lead to anxiety and depression.

Autonomic neuropathy can cause problems with how your organs work, including problems with your heart rate and blood pressure, digestion, urination, and ability to sense when you have low blood glucose.

To prevent diabetic neuropathy, it is important to manage your diabetes by managing your blood glucose, blood pressure, and cholesterol levels.

You should also take the following steps to help prevent diabetes-related nerve damage:

If you have diabetic neuropathy, you should manage your diabetes, which means managing your blood glucose, blood pressure, cholesterol levels, and weight to keep nerve damage from getting worse.

Foot care is very important for all people with diabetes, and its even more important if you have peripheral neuropathy. Check your feet for problems every day, and take good care of your feet. See your doctor for a neurological exam and a foot exam at least once a yearmore often if you have foot problems.

[1] Pop-Busui R, Boulton AJ, Feldman EL, et al. Diabetic neuropathy: a position statement by the American Diabetes Association. Diabetes Care. 2017;40(1):136154.

[2] Izenberg A, Perkins BA, Bril V. Diabetic neuropathies. Seminars in Neurology. 2015;35(4):424430.

Follow this link:

What Is Diabetic Neuropathy? | NIDDK

This video player is not support on your device, please click HERE to try a different player. We apologize for this inconvenience.

How long would YOU like to be pain free?

Look, I know you're skeptical. You should be. Look at all the big drug companies who are lying to you each and every day trying to convince you that their dangerous (sometimes deadly!) drugs are safe.

So I thought there's no better way for you to find out if Heal-n-Soothe will work for you, than having you try it. And that's why I'd like to send you a 90 count bottle, a 30 day supply, for free. You just pay the shipping and handling.

No matter what your arthritis pain level and frequency, fill out the risk-free acceptance form below to see how well Heal-n-Soothe Arthritis will work for you.

STEP 1: Where Should We Ship Your FREE Bottle?

Country *

Choose your country AFGHANISTANALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH INDIAN OCEAN TERRITORYBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACOTE D'IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND AND MCDONALD ISLANDSHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPALESTINIAN TERRITORY, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIA AND MONTENEGROSEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSSPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESUNITED STATES MINOR OUTLYING ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWE

State *

Choose your state AlabamaAlaskaArizonaArkansasCaliforniaColoradoConnecticutDelawareFloridaGeorgiaHawaiiIdahoIllinoisIndianaIowaKansasKentuckyLouisianaMaineMarylandMassachusettsMichiganMinnesotaMississippiMissouriMontanaNebraskaNevadaNew HampshireNew JerseyNew MexicoNew YorkNorth CarolinaNorth DakotaOhioOklahomaOregonPennsylvaniaRhode IslandSouth CarolinaSouth DakotaTennesseeTexasUSAF, AmericasUSAF, EuropeUSAF, PacificUtahVermontVirginiaWashingtonWashington DCWest VirginiaWisconsinWyoming

Get Your FREE Bottle

Learn about the trouble making vegetable, YES VEGETABLE... that can make your Arthritis worse. (And Make you feel 5 - 10 years older.)

The secret switch inside your body that you can flip to help make it start acting like it did when you were 25 years old.

The real reason why painkillers don't help your pain.

Which special superfood can actually counteract the damage or arthritis.

Adler A, Holub B. Effect of garlic and fish-oil supplementation on serum lipid and lipoprotein concentrations in hypercholesterolemic men. American Journal of Clinical Nutrition. 1997 Feb;65(2):445-50.

NIAMS, NIH, Bethesda, Maryland 20892, USA. Arthritis & Rheumatology (Impact Factor: 7.87).06/1998; 41(5):778-99. DOI: 10.1002/1529-0131(199805)41:5<778::AID-ART4>3.0.CO;2-V Source: PubMed

Hrlimann, David, Frank Enseleit, and Priv-Doz Dr Frank Ruschitzka. Rheumatoide arthritis, inflammation und atherosklerose. Herz 29.8 (2004): 760-768.

Schett, Georg. Rheumatoid arthritis: inflammation and bone loss. Wiener Medizinische Wochenschrift 156.1-2 (2006): 34-41.

Read the original:
5 Worst Foods for Arthritis and Joint Pain

methotrexate Rx X N X 94reviews

6.0

Generic name:methotrexate systemic

Brand names: Otrexup, Rasuvo, Rheumatrex Dose Pack, Trexall showall

Drug class: antimetabolites, antirheumatics, antipsoriatics, other immunosuppressants

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

8.0

Generic name:celecoxib systemic

Drug class: cox-2 inhibitors

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

6.0

Generic name:hydroxychloroquine systemic

Drug class: antirheumatics, antimalarial quinolines

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

8.0

Generic name:prednisone systemic

Brand name: Rayos

Drug class: glucocorticoids

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

7.0

Generic name:etanercept systemic

Drug class: antirheumatics, TNF alfa inhibitors

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

6.0

Generic name:meloxicam systemic

Brand name: Mobic

Drug class: Nonsteroidal anti-inflammatory drugs

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

6.0

Generic name:adalimumab systemic

Drug class: antirheumatics, TNF alfa inhibitors

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

6.0

Generic name:hydroxychloroquine systemic

Brand name: Plaquenil

Drug class: antirheumatics, antimalarial quinolines

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

7.0

Generic name:tocilizumab systemic

Drug class: interleukin inhibitors

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

6.0

Generic name:leflunomide systemic

Drug class: antirheumatics, selective immunosuppressants

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

5.0

Generic name:sulfasalazine systemic

Brand names: Sulfazine, Azulfidine, Azulfidine EN-tabs

Drug class: antirheumatics, 5-aminosalicylates

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

8.0

Generic name:infliximab systemic

Drug class: antirheumatics, TNF alfa inhibitors

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

6.0

Generic name:leflunomide systemic

Brand name: Arava

Drug class: antirheumatics, selective immunosuppressants

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

6.0

Generic name:meloxicam systemic

Drug class: Nonsteroidal anti-inflammatory drugs

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

6.0

Generic name:acetaminophen / hydrocodone systemic

Drug class: narcotic analgesic combinations

For consumers: dosage, interactions, side effects

For professionals: Prescribing Information

Off Label: Yes

5.0

Generic name:abatacept systemic

Drug class: antirheumatics, selective immunosuppressants

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

9.0

Generic name:acetaminophen / hydrocodone systemic

Drug class: narcotic analgesic combinations

For consumers: dosage, interactions, side effects

For professionals: Prescribing Information

Off Label: Yes

7.0

Generic name:diclofenac systemic

Brand names: Voltaren, Cataflam, Voltaren-XR

Drug class: Nonsteroidal anti-inflammatory drugs

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

Continued here:
List of Rheumatoid Arthritis Medications (222 Compared ...

What Is Arthritis?

Arthritis (say: arth-ry-tiss) is a disease that causes swelling, stiffness, and pain in a person's joints.Joints are where two bones meet, allowing our bodies to move the hips, knees, ankles, elbows, shoulders, knuckles, etc. Joints contain synovial fluid, which acts as a lubricant to help them move easily.Arthritis can keep joints from working properly.

But isn't arthritis something that only old people get?

Actually, kids can get a kind of arthritis called juvenile idiopathic arthritis or JIA (it's also called juvenile rheumatoid arthritis, or JRA). Juvenile means young, so this means that JIA is different from the arthritis that adults get. Kids can have many different types of arthritis, but JIA is the most common.

Many problems can cause pain and swelling of the joints, so a doctor will want to know how long these problems have been going on. To be considered JIA, the joints must have swelling and pain for at least 6 weeks.

No one really knows what causes JIA. Something in the environment, like a virus, may trigger the disease in kids that already have certain genes that make it more likely for them to get it. (Genes are like instructions to the body on how to work. Genes are passed on from parents to their children and they decide everything from the color of a person's eyes to whether that person has a tendency to get a particular disease. Genes are part of our DNA and are found in the body's cells.)

JIA is not contagious, so you can't catch it from someone else.

Arthritis is an autoimmune (say: aw-toe-i-myoon) disease. An autoimmune disease means a person's immune system makes a mistake and attacks the body's own tissues or organs. Normally, a kid's immune system sends out white blood cells to protect the body and fight outside invaders like bacteria and viruses that can make a kid sick. But with an autoimmune disease like JIA, the immune system makes a mistake and attacks healthy cells.

Instead of recognizing the healthy cells and saying, "Hi, nice to see you," the immune system thinks the healthy cells need to be destroyed and releases chemicals to fight the healthy cells. The chemicals released by the immune system cause the pain and swelling that can happen with arthritis.

Just because a joint hurts doesn't mean a kid has JIA. A joint might hurt for a lot of different reasons, which is why it's important to see a doctor to figure out what the problem is.

The doctor will ask a lot of questions: How long has the kid had joint problems? Does he or she feel stiff when getting up or after resting? Are the joints swollen? Was there an injury? Could another problem be causing arthritis, such as Lyme disease? Is there a family history of arthritis or other autoimmune diseases?

Getting these answers and doing a physical exam, blood tests, and X-rays will help the doctor figure out if it is JIA. If your doctor thinks you may have it, he or she may send you to see a doctor who specializes in the diagnosis and treatment of arthritis. This kind of doctor is called a rheumatologist (say: roo-muh-tol-oh-jist).

Some kids who have JIA might take medicine like ibuprofen to help control pain and inflammation. If the arthritis is more severe, they may need to take other medicines to help lower the pain and inflammation. Some of these medicines are pills, but others are shots.

It's important that kids with JIA keep their joints moving. Often a kid will see a physical therapist or occupational therapist. In addition to working with children to move their joints and strengthen their muscles, these therapists can help create special exercise programs for home or school that can help a kid stay active.

In addition to joint problems, JIA may cause uveitis (say: yoo-vee-eye-tus), an inflammation of the eye that can lead to problems with vision if it's not treated. All kids diagnosed with JIA should get their eyes checked by an ophthalmologist, a doctor who specializes in diagnosing and treating eye problems. If the eyes are affected, they may be treated with eye drops.

Besides taking medicines, akid can do a few things to help with the symptoms of JIA:

Kids with JIA can have a lot of stiffness when they first wake up in the morning. Once their joints warm up, they can usually move more easily. That's why you might notice that someone with JIA has trouble moving early in the day, but seems better later on.

It's important to find a good balance between activity (which helps kids stay flexible) and rest (which everyone needs). Swimming is a great exercise for someone with JIA. It stretches a lot of different muscles and tendons and helps keep a kid moving and flexible. It's important to stay active even when a kid isn't having symptoms.

Sometimes kids with JIA can go a long time, even months or years, without the disease bothering them. Then it comes back. This is called a flare-up or flare. Flare-ups just happen and can't be prevented. It can be frustrating if a flare-up happens on a day when the kid would like to be doing something fun, like attending a birthday party.

If you know someone with JIA, you may offer to carry books or give other help, if needed. It's also OK if the person doesn't want help.

The good news is that many kids with JIA will outgrow it. About half of kids with JIA may not need treatment as adults.

And even when the arthritis flares up, almost all kids with JIA can control it with medicine and other treatments, which means they can do most things that other kids can do.

Date reviewed: April 2016

View post:
Arthritis (for Kids)

Arthritis is a group of diseases that cause painful and swollen joints. Osteoarthritis typically develops gradually and can cause pain and stiffness. Rheumatoid arthritis (RA) is more aggressive and occurs when the body attacks the joints. RA causes painful, inflamed joints and can result in permanent damage. Certain genes also make some people more likely to develop RA.

If you have RA, a diet change could help you, and perhaps even eliminate your pain entirely. In research studies, many people who cut out certain trigger foods find that their pain improves or goes away. The reason, presumably, is that certain foods spark inflammation in the joints. When those foods are gone, so is the inflammation.

A survey of more than 1,000 arthritis patients revealed that red meat, sugar, fat, salt, caffeine, and nightshade plants (e.g., tomatoes, eggplant) most commonly worsen the condition. Research also shows that dairy protein may make symptoms worse.

One study looked at the effects of a very low-fat vegan diet on people with moderate-to-severe RA. After only four weeks on the diet, people had significant improvements in morning stiffness, RA pain, joint tenderness, and joint swelling.

People with osteoarthritis can also benefit from dietary changes. A 2015 study found that people eating a whole-food, plant-based diet significantly decreased their osteoarthritis painin just two weeks. By the end of the six-week study, they reported more energy and better physical functioning, too.

Another study found that a high-fiber diet lowers the risk for knee osteoarthritis by up to 61 percent.

Why Does it Work?

Plant-based diets are often lower in fat and contain different kinds of fat than diets with animal products. For example, many whole plant foods have an optimal ratio of omega-6 to omega-3 fats. Healthful weight loss from eating a vegan diet is also anti-inflammatory, further helping cool irritated joints.

Here's how to get started with pain-safe foods.For two weeks:

If your diet change makes your pain disappear or improve, the next step is to find out which foods are your triggers. To do this, simply reintroduce the eliminated foods one at a time, every two days, to see whether any symptoms result.

Pain-Safe Foods

Pain-safe foods virtually never contribute to arthritis, headaches, or other painful conditions. These include:

Common Pain Triggers

Common triggers often cause pain in susceptible people. Certain drinks and additives are also common triggers, including alcoholic beverages (especially red wine), caffeinated drinks (coffee, tea, and colas), monosodium glutamate, aspartame (NutraSweet), and nitrites. Here are the common food triggers, also known as the "Dirty Dozen":

Excerpt from:
Arthritis - pcrm.org

You may not be thinking much about your arthritis as youre walking down the grocery store aisles or looking at a restaurant menubut maybe you should start.

This tasty recipe involves cauliflower, a great anti-inflammatory vegetable Video: Parmesan & Balsamic Vinegar Roasted Cauliflower for Arthritis Pain Relief

There are several types of foods known to either promote or suppress inflammation in our bodies. If you seek out the anti-inflammatory options and avoid the inflammatory options, you may be able to ease arthritis pain and symptoms.

See What Are Anti-Inflammatory Foods?

Heres a guide to the food choices you should steer clear of in order to help your arthritis.

See Integrative Arthritis Therapies and Nutrition

Article continues below

Avoid processed foods such as baked goods and prepackaged meals and snacks. These items contain trans fats to help preserve them, and trans fats trigger systemic inflammation. To dodge trans fats, avoid any foods labeled as containing partially hydrogenated oils.

See Foods to Avoid with Fibromyalgia

Foods that contain refined sugarincluding pastries, chocolate, candy, soda, and even fruit juicestrigger the release of proteins in the body called cytokines, which cause inflammation. Sugar is labeled many ways in food items; in addition to sugar, watch for corn syrup, fructose, sucrose, or maltose in the ingredient list.

Meatespecially red meatis high in saturated fats, which cause high cholesterol and inflammation. On top of this, meat also contains high levels of advanced glycation end products (AGEs) that stimulate inflammation, particularly when meat is cooked by broiling, grilling, roasting, or frying it.1

Its not just fried chicken you should avoid, though. Other fried foods, such as donuts and French fries, contain trans fats in addition to AGEs.

See An Anti-Inflammatory Diet for Arthritis

This includes white bread, white pasta, and crackers. Refined grains (as opposed to whole grain products) cause a spike in blood glucose level, which has been shown to increase levels of several inflammation-markers in the body.

Another factor to consider about grains: People with gluten sensitivities may experience joint pain and inflammation from consuming wheat products.

See How Gluten Can Cause Joint Pain

Cheese, butter, cream cheese, margarine, and mayonnaise are all high is both saturated fats and AGEstheyre big inflammation triggers and should be consumed sparingly.

Corn, peanut, sunflower, safflower, and soy oils are high in omega-6 fatty acids, which are healthy in small doses. But excessive omega-6 consumption can trigger inflammatory chemicals.

This is not the case for the types of oils rich in omega-3 fatty acids, such as olive, canola, and flaxseed oils. These varieties are healthy, even in larger amounts.

See The Ins and Outs of an Anti-Inflammatory Diet

Avoiding foods and drinks that trigger inflammation is not just good for your arthritis. An anti-inflammatory diet can also help prevent other chronic conditions like heart disease and diabetes.

See Ingredients That May Trigger Fibromyalgia Symptoms

Before you despair that everything tasty seems to be off-limits if you want to practice an anti-inflammatory diet, keep in mind that a few simple swaps can often make the difference between healthy and unhealthy food choices. For example, cook with canola oil instead of corn oil, or swap out white bread for whole grain bread.

Managing RA Fatigue Through Diet and Exercise

Gout Prevention Diet

Read the original post:
In the Kitchen with Arthritis: Foods to Avoid

Arthritis of the knee joint is one of the most common causes of knee pain. There are different types of arthritis that can affect the knee joint, and the treatments may vary depending on the specific condition that is causing the symptoms.

Osteoarthritis is the most common type of knee arthritis. Also called wear-and-tear arthritis or degenerative joint disease, osteoarthritis is characterized by progressive wearing away of the cartilage in the joint. As the protective cartilage is worn away, bone is exposed, the knee becomes swollen, and activities become increasingly painful.

Knee arthritis symptoms tend to gradually progress as the condition worsens, however, symptoms may suddenly worsen with minor injury or overuse. Some patients report long episodes of mild symptoms, with sudden changes that increase the severity of their symptoms. Often patients report good months and bad months, or symptoms that fluctuate with the weather. This is important to understand because comparing the symptoms of arthritis on one particular day may not accurately represent the overall progression of the condition. Since there is not a cure for arthritis, learning ways to slow the progression of arthritis is also important.

Treatment should begin with the most basic steps and progress to the more invasive, possibly including surgery. Not all treatments are appropriate for every patient, and you should have a discussion with your doctor to determine which treatments are appropriate for your particular situation. The range of options includes:

See the rest here:
Knee Arthritis Diagnosis and Treatment - verywellhealth.com

TYLENOL 8-HR Arthritis Pain | TYLENOLSkip to main content

Works fast and lasts all day, up to 8 hours.Available as caplets.

Enroll in a program to help you on your journey and get personalized support.

Get the facts about joint pain and osteoarthritis.

This website contains current product information and may differ from the information on the product packaging you may have.

Enroll in a program to help you on your journey and get personalized support.

Get the facts about joint pain and osteoarthritis.

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:Yes

Review Text:

Fast relief recommended by dr. Best thing ever for me would recommend it to anyone and everyone who has arthritis

Recommended:

Yes, I'd recommend this product

Overall:

12345

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:Yes

Review Text:

Life saver! I find that when I take one Tylenol Arthritis with one Aleve, I have a good 7/8 hours Pain Free From My Rgeumatoid Arthritis. I asked my doctor if it was safe for me to take and he said YES!! When I have a bad flare, I might need stronger medication but this works very well! Im trying to just take this along with herbal supplements for my arthritis

Recommended:

Yes, I'd recommend this product

Overall:

12345

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:Yes

Review Text:

Tylenol 8hr. Arthritis formula was more effective at controlling my pain than most of the medications the doctor prescribed for me after I hurt my lower back and had sciatica in my left leg for about a year.

Recommended:

Yes, I'd recommend this product

Overall:

12345

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:No

Review Text:

I think Tylenol is good for some headaches, but it doesnt seem to touch the pain when its muscular or for joints. I have arthritis in my hands and lower back. It really was almost like I had taken nothing. I kept taking it, hoping that it needed to build up in my system or something. Ibrupophen seems to work better for those kind of pains. I cant take those anymore due to stomach issues. Is Tylenol even for inflammation? What makes this good for arthritis? The high dosage amount? I had high hopes. That was just a waste of money.

Recommended:

Yes, I'd recommend this product

Overall:

12345

Client Responses:

Thanks for your feedback! We're so sorry to hear you haven't been feeling relief, and we want to learn more. Give us a call at 1-877-895-3665, we're here from 9AM to 5:30PM ET Monday through Friday. Hope to hear from you soon!

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:No

Review Text:

I took two for Arthritis pain it never helped. The only reason I'm taking Tylenol is because my doctor said it was better for me than another brand I was taking that did work for me.

Recommended:

No, I would not recommend this product

Overall:

12345

Client Responses:

Hi there, thanks for leaving your review! We're sorry to hear you didn't find relief with this product, so we'd like to learn more and help make it up to you. Please give us a call at 1-877-895-3665 from 9AM - 5:30PM ET, Monday through Friday. Hope to hear from you soon!

Helpfulness:

Was this review helpful to you?

Review Text:

yeah! thanks for sharing this information. here I want to share About homeopathy treatment for Arthritis. Arthritis is a term often used to mean any disorder that affects joints. A joint is an area, where two different bones meet. I suggest livehomeo is the best clinics information for Arthritis treatment. visit for more details : https://www.livehomeo.com/treatments/fight-arthritis-fatigue/

Recommended:

Yes, I'd recommend this product

Location:

Hyderabad, Telangana, India

Overall:

12345

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:No

Review Text:

This product works well on pain but the side effects are too severe on the stomach.

Recommended:

No, I would not recommend this product

Overall:

12345

Client Responses:

We're sorry to hear this and we'd like to learn more! Please give us a call at 1-877-895-3665 from 9AM - 5:30PM ET, Monday through Friday. Thank you!

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:Yes

Review Text:

Does this work for night time pain? Is there a Tylenol pm for arthritis?

Overall:

12345

Helpfulness:

Was this review helpful to you?

Log in using your account with

By registering, you agree to receive additional communications regarding product information, promotions, newsletters and surveys from our site. If you choose to register with a social provider, certain information will be shared by your social provider with our site.

{* traditionalSignIn_signInButton *}

Welcome back, {* welcomeName *}!

Welcome back!

{* traditionalSignIn_signInButton *}

All Fields required, unless otherwise indicated

Will be used as your user name

By submitting your information above, you agree that the information you provide will be governed by our site's Privacy Policy.

By submitting your information you agree to our sites Privacy Policy.

All fields required unless otherwise indicated

See more here:
TYLENOL 8-HR Arthritis Pain | TYLENOL

At Montefiore, our approach to genetic testing and research demonstrates a unique recognition of the increasing importance of this field. We are one of the only institutions worldwide to have placed our Division of Reproductive Genetics within our Obstetrics & Gynecology Department, rather than within pediatrics, which allows our patients to receive highly specialized care before and during all stages of their pregnancies.

With our ever-growing knowledge of genetics, our approach to prenatal care and overall healthcare for women incorporates a new range of interventions and treatments. We are expanding the field further with ongoing research and patient care, and by training the next generation of experts through Montefiore's affiliation with the Albert Einstein College of Medicine.

Our doctors are among only a few nationally who have a specialty in medical genetics coupled with a foundation in gynecology. Women can expect comprehensive care that addresses all aspects of their own health and prenatal needs.

When a pregnant woman receives an ultrasound at Montefiore, we apply our expertise in genetics to look for Down Syndrome and other syndromes and birth defects, whether related to chromosomes or single genes. We continually expand our expertise by performing more than 1,500 amniocenteses annually. Our doctors have published many papers on topics related to unusual ultrasounds.

Montefiore's range of experts and well-coordinated services offer patients complete care without the stress of traveling between multiple sites. Such centralized treatment is especially important because of the emotional and physical stress of dealing with a serious problem. After managing women's care for more than 30 years, we have ample experience synchronizing treatments between departments such as Gynecology, Obstetrics, Pathology and Psychiatry.

We are also expanding our work on the link between genetics and infertility, including male infertility. Those seeking infertility treatments, such as in vitro fertilization, can talk to our expert geneticists about the latest advancements in the field in genetic counseling.

And because we work closely with our colleagues in pediatrics, our patients can be confident that they will receive informed, caring treatment through every stage of pregnancy and childbirth.

We are also committed to expanding our expertise in the field of cancer genetics specific to women, including testing for:

As we gain a greater understanding of the genes that predispose people to specific cancers, we are able to save lives by using a complete family history and genetic testing to identify patients who may be at risk.

Women can now receive therapies to treat and prevent cancer earlier than ever before. Montefiore's leadership in the field is evident in the increasing number of patients who are referred to us by doctors at other medical centers in the region because of our state-of-the-art care.

Please print and fill out the Genetics Questionnaire before your appointment with the geneticist or genetic counselor because it will be helpful for us. If you have medical records or family records, please bring them with you to your appointment.

Go here to read the rest:
Genetic Counseling - Bronx - Westchester - New York ...

This video player is not support on your device, please click HERE to try a different player. We apologize for this inconvenience.

*Results will vary based on how long and how closely you follow the information presented, as well as other individual biological factors.

How long would YOU like to be pain free?

Look, I know you're skeptical. You should be. Look at all the big drug companies who are lying to you each and every day trying to convince you that their dangerous (sometimes deadly!) drugs are safe.

So I thought there's no better way for you to find out if Heal-n-Soothe will work for you, than having you try it. And that's why I'd like to send you a 90 count bottle, a 30 day supply, for free. You just pay the shipping and handling.

No matter what your arthritis pain level and frequency, fill out the risk-free acceptance form below to see how well Heal-n-Soothe will work for you.

STEP 1: Where Should We Ship Your FREE Bottle?

Country *

Choose your country AFGHANISTANALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH INDIAN OCEAN TERRITORYBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACOTE D'IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND AND MCDONALD ISLANDSHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPALESTINIAN TERRITORY, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIA AND MONTENEGROSEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSSPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESUNITED STATES MINOR OUTLYING ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWE

State *

Choose your state AlabamaAlaskaArizonaArkansasCaliforniaColoradoConnecticutDelawareFloridaGeorgiaHawaiiIdahoIllinoisIndianaIowaKansasKentuckyLouisianaMaineMarylandMassachusettsMichiganMinnesotaMississippiMissouriMontanaNebraskaNevadaNew HampshireNew JerseyNew MexicoNew YorkNorth CarolinaNorth DakotaOhioOklahomaOregonPennsylvaniaRhode IslandSouth CarolinaSouth DakotaTennesseeTexasUSAF, AmericasUSAF, EuropeUSAF, PacificUtahVermontVirginiaWashingtonWashington DCWest VirginiaWisconsinWyoming

Get Your FREE Bottle

Learn about the trouble making vegetable, YES VEGETABLE that can make your Arthritis worse. (And Make you feel 5 - 10 years older.)

The secret switch inside your body that you can flip to help make it start acting like it did when you were 25 years old.

The real reason why pain killers don't help your pain.

Which special superfood can actually counteract the damage or arthritis.

Adler A, Holub B. Effect of garlic and fish-oil supplementation on serum lipid and lipoprotein concentrations in hypercholesterolemic men. American Journal of Clinical Nutrition. 1997 Feb;65(2):445-50.

NIAMS, NIH, Bethesda, Maryland 20892, USA. Arthritis & Rheumatology (Impact Factor: 7.87).06/1998; 41(5):778-99. DOI: 10.1002/1529-0131(199805)41:5<778::AID-ART4>3.0.CO;2-V Source: PubMed

Hrlimann, David, Frank Enseleit, and Priv-Doz Dr Frank Ruschitzka. Rheumatoide arthritis, inflammation und atherosklerose. Herz 29.8 (2004): 760-768.

Schett, Georg. Rheumatoid arthritis: inflammation and bone loss. Wiener Medizinische Wochenschrift 156.1-2 (2006): 34-41.

See the article here:
The 5 Worst Foods To For Arthritis

Overview

Complementary and alternative medicine (CAM) is the popular name for health care practices that traditionally have not been part of conventional medicine. In many cases, as evidence of efficacy and safety grows, these therapies are being combined with conventional medicine.

Thus, the term alternative has been dropped and replaced with newer terms, such as complementary and integrative medicine, integrative medicine and health, or just integrative medicine.

Integrative medicine can help people with cancer, persistent pain, chronic fatigue, fibromyalgia and many other conditions better manage their symptoms and improve their quality of life by reducing fatigue, pain and anxiety. Examples of common practices include:

The treatments promoted in integrative medicine are not substitutes for conventional medical care. They should be used in concert with standard medical treatment.

Certain therapies and products are not recommended at all or not recommended for certain conditions or people. The National Center for Complementary and Integrative Health is a good tool for researching a therapy you're considering. It's also important to talk with your health care provider before trying something new.

Explore Mayo Clinic studies testing new treatments, interventions and tests as a means to prevent, detect, treat or manage this disease.

Integrative medicine care at Mayo Clinic

June 29, 2018

Read more from the original source:
Integrative medicine - Mayo Clinic

Integrative medicine and functional medicine focus on allowing the body to heal and regulate itself by living nutritionally and physically well. Your provider will work with you to determine your health needs based on a whole-body approach. Integrative medicine is healing-oriented and emphasizes the relationship between provider and patient, ensuring a full understanding of your inner well-being.

Our practices are based on a scientific understanding of how the body reacts to circumstances within itself. We are all built uniquely and with a true understanding of what wellness and health means to us as an individual, our bodies are capable of self-rejuvenating and healing so that we can feel alive and well again.

These are a few of the services that may be offered to you as an integrative medicine patient.

Hormones affect all aspects of our lives including our energy, sense of well-being and our immune system. We offer evaluation and treatment with bio-identical options for both women and men. We monitor levels on treatment and work with individuals to achieve balance and relief of symptoms associated with perimenopause, menopause and andropause.

Inflammation is the silent fire that causes health issues like heart disease, diabetes, obesity, hypertension and cancers by turning on and off the genes that cause or prevent disease. We offer evaluation of inflammatory markers and suggest lifestyle changes, nutrition, supplements and medications to help stop inflammation in its path.

Nutrition isnt just about maintaining a healthy weight; its about preventing disease. We can look at your individual bio-chemistry to help design a program that takes into account your genetics and food sensitivities. Let us help you find the right fuel for your body.

Read more here:
Integrative Medicine | Parkview Health | NE Indiana and NW ...

By Dr. Mercola

Arthroscopic knee surgery is one of the most common unnecessary surgeries performed todayalong with back and hip surgeries, pacemakers, cardiac angioplasties, hysterectomies, and Cesarean sections.

Several studies over the past decade have highlighted questions about arthroscopic knee surgery, and now, you can add one more to the pile. The meniscus inside your knee is a thin crescent-shaped disc of cartilage that serves as a cushion between your femur and tibia and helps stabilize your knees.

Over time, your meniscus can develop tears, especially if you have arthritis. The standard orthopedic surgeons intervention for meniscal tears is performing an arthroscopic partial meniscectomytrimming the torn meniscus and smoothing the jagged edges of what remains, which assumes the tear is whats causing your pain. However, that may be a faulty assumption.

This is a Flash-based video and may not be viewable on mobile devices.

Visit the Mercola Video Library

Knee Surgery No Better Than ShamBioAstin Hawaiian Asta...Buy New $23.97(as of 02:10 EST - Details)

This latest study, conducted in Finland, examined 146 patients with degenerative meniscal tears (caused by wear and tear, not acute injury).1Researchers divided patients into two groups.

One group received the standard surgery, and the other received a sham surgeryin other words, a fake or placebo intervention where no actual surgery takes place. The study excluded people with knee arthritis, because they tend not to benefit as much from meniscus surgery and the researchers wanted to ascertain if the surgery helps under ideal circumstances.2

The sham surgery involved the physicians making an incision and poking around without any actual cartilage shaving or cutting. Many of the patients were given epidural anesthesia, so they were awake, making it necessary for surgical staff to use their theatrical talents to pull off a believable sham surgery.

The outcome? One year later, both groups reported equally favorable responses to the procedureprimarily, reduction in knee pain. In the end, the researchers concluded that the real knee surgeries offered no better outcomes than the sham surgeries.

Arthroscopic surgery on the meniscus is the most common orthopedic procedure in the US, and according to this study, is performed about 700,000 times a year to the tune of $4 billion. Any surgeon who tells you this is the best or only option for your osteoarthritic knee pain will not have a leg to stand on when you show him or her all of the evidence to the contrary.

Arthroscopic Surgeries Have an Embarrassing Track Record

Prior to the Finnish study, there were already three prior studies of note that should have orthopedic surgeons rethinking how they treat their knee patients:

See the pattern emerging here? Its hard to miss! Eighty percent of meniscal tears develop from wear and tear over time.6If you have pain in your knees from ordinary activities or arthritis, you may be better off skipping the surgery and going straight to physical therapy.

Or better yet, get some treatments with an infrared laser that I discussed in detail withDr. Harrington.

Of course, there are other non-invasive therapies that can be helpful as well. But its becoming quite clear that a torn meniscusat least, the wear-and-tear varietyis not going to be helped by a surgical trim. Surgeries come with all sorts of risks, and there is no point in exposing yourself to these without some clear advantage.

If you have a torn meniscus from an accident or injury, the scenario may be different, but I would still recommend you getting a second or even third opinion before going under the knife.

The Power of Placebo

With TWO studies now highlighting the benefits of placebo knee surgeries, the power ofplacebojust cant be ignored. Placebos typically have far fewer side effects (if any) than prescription drugs, injections, or actual surgeriesand they often work just as well as the standard of care.Studies have shown that if youthinkyoure receiving a treatment, and you expect that treatment to work, it often doeseven if you know youre receiving aplacebo.

This was beautifully demonstrated in the Finnish studythe knee surgery patients knew they might be having a sham surgery, yet they experienced the benefits anyway. But how do placebos work? How can your brain produce healing just because youbelieveit should be happening?Although the exact mechanisms of the placebo effect are not well understood, it seems related to changes in your brain in response to different psychosocial stimuli. Areas of your brain associated with expectations, anxiety, and rewards seem to be involved.Scientific Americanreported:7

In recent decades reports have confirmed the efficacy of various sham treatments in nearly all areas of medicine. Placebos have helped alleviate pain, depression, anxiety, Parkinsons disease, inflammatory disorders and even cancer.

Placebo effects can arise not only from a conscious belief in a drug but also from subconscious associations between recovery and the experience of being treatedfrom the pinch of a shot to a doctors white coat.Such subliminal conditioning can control bodily processes of which we are unaware, such as immune responses and the release of hormones Researchers have decoded some of the biology of placebo responses, demonstrating that they stem from active processes in the brain.

You can tap into your own placebo effect with techniques such asEFT or Emotional Freedom Technique.This is a new way of thinking about healing for most people that can be extremely powerful, especially when combined with a positive outlook and a proactive,disease-preventive lifestyle.

Your Secret Weapon Against Knee Pain: Exercise

Exercise is the real medicine for pain in your joints.Exercisehelps prevent and relieve joint pain through a number of mechanisms, including strengthening key supportive muscles, improving flexibility and range of motion, improving bone strength, and helping you optimize your weight. The notion that exercise is detrimental to your joints is a serious misconception; there is no evidence to support this belief. Its simply a myth that you can wear down your knees just from average levels of exercise and/or normal activity.

This is not to say that traditional pavement-pounding, likedistance running, is going to be of any benefit to your kneesIm talking about low-impact but effective exercise, such ashigh-intensity interval training (HIIT),high-intensity cardio,weight training,stretching, and core work. If you find youre in pain for more than an hour after your workout, you should slow down or choose another form of exercisethere really are plenty to choose from.

If youve already developed osteoarthritis in your knees, youll want to incorporate exercises that strengthen your quadriceps muscle at the front of your thigh. And, rather than running and other high-impact activities, you may be better off with non-weight-bearing exercises like swimming and cycling. Strengthening and stretching the areas around, above, and below your knee is key to reducing most knee pain, which is the goal of the exercises I demonstrate in the video above. I recommend a qualified physiotherapist to properly assist you with your exercises to avoid injury. Make sure to wear appropriate footwear for all of your daily activities. Spiked heels and very flat soled shoes place unnatural stresses on your knees. Goodpostureis important as well.

For joint pain, many physicians commonly recommend anti-inflammatory drugs (non-steroidal anti-inflammatories or NSAIDs) and analgesics (such as Tylenol) to their osteoarthritis patients. I dont recommend the chronic use of these drugs due to significant side effects, which may include kidney and/or liver damage. There are safer and more effective natural options for relieving joint pain. Although popular, I am also not much of aglucosamine and chondroitinfan because studies have failed to demonstrate their effectiveness. However, there are some very effective natural remedies that are truly backed up by science. The following are my favorites:

Sun exposure is your best option, because your skin produces two types of sulfur in response to sun exposure: cholesterol sulfate and vitamin D3 sulfate. Sulfur plays a vital role in the structure and biological activity of both proteins and enzymes. If you dont have sufficient sulfur in your body, this deficiency can create a number of health problems, including negative impacts on your joints and connective tissue. Which brings us to the next item

Methylsulfonylmethane (known asMSM) is another alternative you might find helpful. MSM is an organic form of sulfur and a potent antioxidant naturally found in many plants, and is available in supplement form. For more on the benefits of MSM, I recommend listening to this interview.

Eggshell membrane also contains transforming growth factor-B, a protein that helps with tissue rejuvenation, in addition to other amino acids and structural components that provide your joints with the building blocks they need to build cartilage.

Sources and References

The Best of Joseph Mercola

See more here:
Avoid This Unnecessary Surgery - LewRockwell

Longevity is the ability to live or persist for extended periods of time.

Unlike some of their other abilities like superhuman strength, speed, stamina, and invulnerability, this ability appears to manifest for Kryptonians a while later after they get introduced to an environment under a yellow sun, and as such, this ability seems to require a certain amount of storage of rays given off by a yellow sun for it to take effect [citationneeded]

The Kryptonian machine computer program called Brainiac appeared to operate indefinitely. [citationneeded]Davis Bloome can live for very long periods of time. [citationneeded]

Among Kryptonians, blue kryptonite can hinder this ability. Dax-Ur aged while wearing a blue kryptonite rock on his wrist.

Darkseid was present on Earth during its darkest points in history but was banished away by Orion's bow.

Curtis Knox is an immortal, the source of his immortality was never discovered, he was around centuries before the first meteor showers occurred.

Clark Kent was initially afraid of this ability while he was an adolescent, fearing the that he would eventually outlive everyone including the ones he loves. After his friend Ryan dies, he learns that time is valuable, and that he shouldn't take someone's life for granted, as it will end sometime. When the Crystal of Air gets stained with human blood, a second meteor shower is triggered, and the Black Ship ventures to Earth, bringing Aethyr and Nam-Ek to Earth. Here, they attempt to get Kal-El to join them in making Earth a utopia and a new Krypton in which they would rule forever but Clark denies them and traps them in the Phantom Zone. After Clark becomes mortal when Jor-El removes his abilities, he gets shot and dies at 7:18 AM. Jor-El inhabits Lionel's body and revives Clark, restoring his powers, so he can complete his Kryptonian destiny because "his mortal journey has ended".

Later on, his cousin Kara reminds him that trying to love Lana and live with her till she grows old is a foolish idea because he will out live her. Clark later accepts this ability, as shown while he was talking with John Jones, admitting that eventually "they'll all be gone".

Please add quotes about longevity and immortality here.

Originally posted here:
Longevity | Smallville Wiki | FANDOM powered by Wikia